Tabuthemen und Politische Polarisierung

Wir reden Klartext und sprechen auch alle die brisanten Fragen an, die heute die Herrschenden unter den Teppich kehren wollen und im Wahlkampf einfach auszublenden. Rechte Betriebsräte und Gewerkschaftsführer fordern zusammen mit der SPD, die VW-Krise aus dem Wahlkampf heraus zu halten.
Tabuthemen und Politische Polarisierung

Grafik: Rote Fahne (unter Verwendung von BMW_gemeinfrei; Mercedes_Daniel Dionne_CC BY-SA 2.0; Porsche_pixabay CC0; VW_Christoph Braun_public domain)

Schulz fordert, die Nordkorea-Kriseaus dem Wahlkampf herauszuhalten“.

Diese Methode nennen bürgerliche Politikwissenschaftlerasymmetrische Demobilisierung“.

Man vermeidet jede Polarisierung und Kontroverse, um politische Gegner möglichst nicht zu mobilisieren.

Wir dagegen werden die politischen Tabuthemen von Merkel und Schulz, den Angriff auf sie und unsere Alleinstellungsmerkmale in den Mittelpunkt des Wahlkampfs rücken!

Und wenn sich dadurch unsere Gegner mobilisiert fühlen, haben wir davor bestimmt keine Angst.

Denn so beeindruckend ist das Mobilisierungspotential dieser Gegner nun auch nicht.

Und außerdem - die Polarisierung ist unser Metier!

Artikelaktionen

MLPD vor Ort
MLPD vor Ort Landesverband Nord Landesverband Nordrhein-Westfalen Landesverband Ost Landesverband Rheinland-Pfalz Hessen Saarland Landesverband Baden-Württemberg Landesverband Bayern
In Deutschland ist die MLPD in über 450 Städten vertreten.
Hier geht es zu den Kontaktadressen an den Orten.
Mehr...